শেনঝেন হাইওয়ে বায়োটেকনোলজি কোং লিমিটেড রায় স্টেরয়েড পাউডার উত্পাদন, আধা-সমাপ্ত তেল, লিকুইড, এইচজিএইচ, পেপটাইডস এবং চীনে স্থানীয় অ্যানথেটিক ড্রাগস।

বিক্রয়
উদ্ধৃতির জন্য আবেদন -
Select Language
বাড়ি
পণ্য
আমাদের সম্পর্কে
কারখানা ভ্রমণ
মান নিয়ন্ত্রণ
আমাদের সাথে যোগাযোগ করুন
উদ্ধৃতির জন্য আবেদন
English
French
German
Italian
Russian
Spanish
Portuguese
Dutch
Greek
Japanese
Korean
Arabic
Hindi
Turkish
Indonesian
Vietnamese
Thai
Bengali
Persian
Polish
বাড়িপণ্য

steroids for hair growth

আমি আমার পণ্য পেয়েছি, আপনি প্যাকিং বুদ্ধিমান এবং নিখুঁত করা হয়, এটা সত্যিই আমাকে বিস্মিত। আমি যত তাড়াতাড়ি সম্ভব আপনার কাছ থেকে আরো অর্ডার হবে। Tks!

—— Robet--Australia

আমি আপনার সাথে বহুবার সহযোগিতা করেছি, আপনার পণ্য গুণমান এত বড়, তাই আমি এখনও আপনার কাছ থেকে পণ্য কিনেছি। ধন্যবাদ

—— Richard---American

হাই সাথি, আপনার সেরা মূল্য এবং উচ্চ বিশুদ্ধতা পণ্য আমার দেশে এত প্রতিযোগিতামূলক, এটি আমাকে অনেক লাভ করতে দেয়, আমার গ্রাহকরা সত্যিই এটি পছন্দ করেন। টক্স

—— Johnson---Canada

তোমার দর্শন লগ করা অনলাইন চ্যাট এখন

steroids for hair growth

(228)

চুল ক্ষতি চিকিত্সা ড্রাগ Minoxidil 99% ন্যানো চুল বৃদ্ধি পাউডার 38304-91-5

চুল ক্ষতি চিকিত্সা ড্রাগ Minoxidil 99% ন্যানো চুল বৃদ্ধি পাউডার 38304-91-5 1. বেসিক বর্ণনা: Minoxidil একটি antihypertensive vasodilator ঔষধ। এটি হ্রাস বা চুল ক্ষতি বন্ধ করে এবং চুল regrowth প্রচার করে। এখন বন্ধ ...আরো পড়ুন
2019-03-13 17:06:04

হোয়াইট ক্রিস্টালিন সলিড চুল বৃদ্ধি স্টেরয়েড Finasteride Proscar এন্টি-এস্ট্রোজেন স্টেরয়েড

হোয়াইট ক্রিস্টালিন সলিড চুল বৃদ্ধি স্টেরয়েড Finasteride Proscar এন্টি-এস্ট্রোজেন স্টেরয়েড দ্রুত বিস্তারিত: পণ্যের নাম: Finasteride এলিয়াস: Proscar CAS: 98319-26-7 এমএফ: C23H36N2O2 মেগাওয়াট: 37২.55 বিশুদ্ধত...আরো পড়ুন
2019-03-13 17:06:20

টেস্টোস্টেরন Enanthate চুল বৃদ্ধি পাউডার হরমোন শারীরিক বিল্ডিং 315-37-7

টেস্টোস্টেরন Enanthate চুল বৃদ্ধি পাউডার হরমোন শারীরিক বিল্ডিং 315-37-7 1. দ্রুত বিস্তারিত: পণ্যের নাম Testosterone Enanthate কারখানার সরবরাহ অন্য নাম টেস্টোস্টেরন enantate; testosterone উত্সাহী; Primoteston সি...আরো পড়ুন
2019-03-13 17:06:15

চুল ক্ষতি চিকিত্সা ড্রাগ Minoxidil বিশুদ্ধতা 99% ন্যূনতম চুল বৃদ্ধি পাউডার CAS 38304-91-5

চুল ক্ষতি চিকিত্সা ড্রাগ Minoxidil 99% ন্যানো চুল বৃদ্ধি পাউডার 38304-91-5 1. বেসিক বর্ণনা: Minoxidil একটি antihypertensive vasodilator ঔষধ। এটি হ্রাস বা চুল ক্ষতি বন্ধ করে এবং চুল regrowth প্রচার করে। এখন বন্ধ ...আরো পড়ুন
2019-03-13 17:06:13

অ্যানেসথেটিভ হেয়ার গ্রাউথ পাউডার প্রোস্কর এনডোনি 98319-26-7 ফিনস্টারডারাইড, প্রস্টাইড

চুলের বৃদ্ধি পাউডার নিরাপদ প্রোস্কর স্থানীয় অ্যানেসথেটিক ড্রাগস অ্যাডনি CAS 98319-26-7 ফিনস্টারডারাইড, প্রস্টেটাইড 1. দ্রুত বিস্তারিত: পণ্যের নাম Formestane কারখানা সরবরাহকারী অন্য নাম Lentaron; 4-হাইড্রক্সি...আরো পড়ুন
2019-03-13 17:06:14

চুল ক্ষতি চিকিত্সা জন্য Dutasteride চুল বৃদ্ধি স্টেরয়েড হরমোন পাউডার Avodart

আত্ম পরিচিতি: আমাদের কোম্পানি 10 বছরেরও বেশি সময় ধরে এই লাইন করছে, আমরা বিশেষ পণ্য, নিরাপদ শিপিং এবং কাস্টমস পাসের জন্য উচ্চ সাফল্যের সাথে অভিজ্ঞ, পরামর্শের জন্য এখানে স্বাগত জানাই: ইমেইল: ariesfeng@ycphar.com ...আরো পড়ুন
2019-03-13 17:06:06

Dutasteride Avodart চুল বৃদ্ধি স্টেরয়েড 99% ফার্মা গ্রেড 164656-23-9

Dutasteride Avodart চুল বৃদ্ধি স্টেরয়েড 99% ফার্মা গ্রেড 164656-23-9 মৌলিক বর্ণনা: গ্ল্যাক্সো স্মিথক্লাইন দ্বারা নির্মিত ডুটস্টারাইড (Avodart), একটি দ্বৈত 5-α reductase নিষ্ক্রিয়কারী যা টেস্টোস্টেরন রূপান্তর ...আরো পড়ুন
2019-03-13 17:06:13

বর্ধিত প্রোস্টেট চিকিত্সা চুল বৃদ্ধি স্টেরয়েড 164656-23-9 ডুয়েজেন

বর্ধিত প্রোস্টেট চিকিত্সা চুল বৃদ্ধি স্টেরয়েড 164656-23-9 ডুয়েজেন 1. দ্রুত বিস্তারিত: Dutasteride উপাধি: Avodart; Duagen CAS NO: 164656-23-9 এমএফ: C27H30F6N2O2 মেগাওয়াট: 528.53 বিশুদ্ধতা: 99% চেহারা: সাদা পা...আরো পড়ুন
2019-03-13 17:06:15

Finasteride চুল বৃদ্ধি স্টেরয়েড হরমোন পাউডার Proscar / Propecia

আত্ম পরিচিতি: আমাদের কোম্পানি 10 বছরেরও বেশি সময় ধরে এই লাইন করছে, আমরা বিশেষ পণ্য, নিরাপদ শিপিং এবং কাস্টমস পাসের জন্য উচ্চ সাফল্যের সাথে অভিজ্ঞ, পরামর্শের জন্য এখানে স্বাগত জানাই: ইমেইল: ariesfeng@ycphar.com ...আরো পড়ুন
2019-03-13 17:06:06

Lyophilized ইনজেক্ট 2mg / শিরা চুল বৃদ্ধি স্টেরয়েড Sermorelin Polypeptide

Lyophilized ইনজেক্ট 2mg / শিরা চুল বৃদ্ধি স্টেরয়েড Sermorelin Polypeptide দ্রুত বিস্তারিত: পণ্য নাম: Sermorelin বিশেষণ প্রতিশব্দ: সেরোমরিন; সেরমরিন অ্যাকটেট; YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2; TYR-ALA-ASP-ALA...আরো পড়ুন
2019-03-13 17:06:33
Page 1 of 10 |< << 1  2  3  4  5  6  7  8  9  10  >> >|