শেনঝেন হাইওয়ে বায়োটেকনোলজি কোং লিমিটেড রায় স্টেরয়েড পাউডার উত্পাদন, আধা-সমাপ্ত তেল, লিকুইড, এইচজিএইচ, পেপটাইডস এবং চীনে স্থানীয় অ্যানথেটিক ড্রাগস।

বিক্রয়
উদ্ধৃতির জন্য আবেদন -
Select Language
বাড়ি
পণ্য
আমাদের সম্পর্কে
কারখানা ভ্রমণ
মান নিয়ন্ত্রণ
আমাদের সাথে যোগাযোগ করুন
উদ্ধৃতির জন্য আবেদন
English
French
German
Italian
Russian
Spanish
Portuguese
Dutch
Greek
Japanese
Korean
Arabic
Hindi
Turkish
Indonesian
Vietnamese
Thai
Bengali
Persian
Polish
বাড়িপণ্যচুল বৃদ্ধি পাউডার

Lyophilized ইনজেক্ট 2mg / শিরা চুল বৃদ্ধি স্টেরয়েড Sermorelin Polypeptide

আমি আমার পণ্য পেয়েছি, আপনি প্যাকিং বুদ্ধিমান এবং নিখুঁত করা হয়, এটা সত্যিই আমাকে বিস্মিত। আমি যত তাড়াতাড়ি সম্ভব আপনার কাছ থেকে আরো অর্ডার হবে। Tks!

—— Robet--Australia

আমি আপনার সাথে বহুবার সহযোগিতা করেছি, আপনার পণ্য গুণমান এত বড়, তাই আমি এখনও আপনার কাছ থেকে পণ্য কিনেছি। ধন্যবাদ

—— Richard---American

হাই সাথি, আপনার সেরা মূল্য এবং উচ্চ বিশুদ্ধতা পণ্য আমার দেশে এত প্রতিযোগিতামূলক, এটি আমাকে অনেক লাভ করতে দেয়, আমার গ্রাহকরা সত্যিই এটি পছন্দ করেন। টক্স

—— Johnson---Canada

তোমার দর্শন লগ করা অনলাইন চ্যাট এখন

Lyophilized ইনজেক্ট 2mg / শিরা চুল বৃদ্ধি স্টেরয়েড Sermorelin Polypeptide

Lyophilized ইনজেক্ট 2mg / শিরা চুল বৃদ্ধি স্টেরয়েড Sermorelin Polypeptide supplier Lyophilized ইনজেক্ট 2mg / শিরা চুল বৃদ্ধি স্টেরয়েড Sermorelin Polypeptide supplier

বড় ইমেজ :  Lyophilized ইনজেক্ট 2mg / শিরা চুল বৃদ্ধি স্টেরয়েড Sermorelin Polypeptide

পণ্যের বিবরণ:

উৎপত্তি স্থল:চীন
পরিচিতিমুলক নাম:SMQ
সাক্ষ্যদান:USP,SGS
মডেল নম্বার:86168-78-7

প্রদান:

ন্যূনতম চাহিদার পরিমাণ:1 কেজি
মূল্য:USD 10g
প্যাকেজিং বিবরণ:আপনি প্রয়োজন হিসাবে
ডেলিভারি সময়:1-3 দিন
পরিশোধের শর্ত:ওয়েস্টার্ন ইউনিয়ন, MoneyGram, T/T
যোগানের ক্ষমতা:1000kg / সপ্তাহ
বিস্তারিত পণ্যের বর্ণনা
নাম: Sermorelin সূত্র: C149H246N44O42S
প্রয়োগ: পেপটাইড ড্রাম উপস্থিতি: Lyophilized পাউডার
সফটওয়ারও: nicole0918 ই-মেইল: 2355935183@ycphar.com

Lyophilized ইনজেক্ট 2mg / শিরা চুল বৃদ্ধি স্টেরয়েড Sermorelin Polypeptide

দ্রুত বিস্তারিত:


পণ্য নাম: Sermorelin
বিশেষণ প্রতিশব্দ: সেরোমরিন; সেরমরিন অ্যাকটেট; YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2; TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG -LYS-Leu-Leu-GLN-এএসপি-Ile-পূরণ-SER-ARG-NH2; TYR-Ala-এএসপি-Ala-Ile-phê-THR-Asn-SER-TYR-ARG-Lys-Val-Leu-GLY -জিএলএন-লেইউ-সের-এলএএ-এআরজি-এলওয়াইএস-লেইউ-এলইউ-জিএলএন-এএসপি-আইএল-এমইটি-এসআরআর-এআরজি-এনএইচ 2 হিউম্যান; এইচ-টিইআরআর-এলএএ-এএসপি-অ্যাল-আইএল-পিএইচ-থএআরআর-এএসএন- এসইআর-টিআইআরআর-এআরজি-এলওয়াইএস-ওয়াল-লেইউ-জিইলি-জিএলএন-লেইউ-সের-এলএএ-এআরজি-লাইস-লিউ-এলইউ-জিএলএন-এএসপি-আইএল-এমইটি-এসইআর-এআরজি-এনএইচ 2; বৃদ্ধি হরমোন রিলেসিং ফ্যাক্টর (1 -29), অ্যামাইড, হিউম্যান, জিআরএফ (1-29) এমাইড (হিউম্যান)
সি এ এস: 86168-78-7
এম এফ: C149H246N44O42S
মেগাওয়াট: 3357,88
পণ্য বিভাগ: এমিনো এসিড ডেরিভেটিভস; পেপটাইড; জিএইচ-আরএইচবিসিটি গবেষণা; সেল জীববিজ্ঞানের জন্য জিএইচ-আরএইচপিপাইডাইড; বৃদ্ধি হরমোন ফ্যাক্টর ফ্যাক্টর; নিউরোপप्াইডাইডস; নিউরোট্রান্সসেশন (স্থূলতা); কারণগুলি ফাঁস করা
ব্যবহার: xanthine অক্সিডেস ইনহিবিটার


প্যাকেজিং এবং ডেলিভারি প্রক্রিয়া:

1. ডেলিভারি: আপনার পেমেন্ট প্রাপ্তির পর 12 ঘন্টার মধ্যে পার্সেলগুলি ব্যবস্থা করা হবে।
2. প্যাকিং: স্টেরয়েড পাউডার কাস্টমস ক্রস যথেষ্ট বিবেচ্যভাবে প্যাক করা হবে
3. বিশ্বব্যাপী নিরাপদে। ঐতিহ্যগত চীনা খাদ্য, ওয়াশিং এবং স্নান আইটেম এবং অন্যান্য উপকরণ, ইত্যাদি মত প্যাকিং ...
4. অতিরিক্ত সেবা: স্টেরয়েডগুলি বাদ দেওয়ার জন্য প্যাকেজের ফটোগুলি সরবরাহ করা হবে।
5. এটি মুক্তি হয় একবার ট্র্যাকিং নম্বর দেওয়া হবে।
6. বিক্রয়োত্তর সেবা: পার্সেল পেয়ে যাওয়ার পরে যেকোন প্রশ্ন, দয়া করে আমাদের সাথে প্রথমবার যোগাযোগ করুন। সমস্যাগুলি আপনার জন্য দ্রুত সমাধান করা হবে।

প্রতিযোগিতামূলক সুবিধা:

  1. চীনা সাগর বন্দরে একটি বৃহৎ পরিমাণে পাত্রে লোড করার সমৃদ্ধ অভিজ্ঞতা;
  2. সুপরিচিত গ্রেপ্তার শিপিং লাইন দ্বারা দ্রুত চালান;
  3. ক্রেতাদের বিশেষ অনুরোধ অনুযায়ী pallets সঙ্গে প্যাকেজিং;
  4. ইমেইল দ্বারা চালানের পরে সর্বোত্তম সেবা প্রদান;
  5. উপলব্ধ ধারক বিক্রয় সেবা সঙ্গে একসঙ্গে cargoes;
  6. ধারক মধ্যে লোড করার আগে এবং পরে পণ্যসম্ভার প্রদান;
  7. চীনা উৎপত্তি থেকে কাঁচামাল;

সংশ্লিষ্ট পণ্য:

পলিপাইপাইড সিরিজ

পণ্যের নাম

সবিস্তার বিবরণী

MGF

2mg / শিশি

পিইজি এমজিএফ

2mg / শিশি

সিএসিসি-1২95 ড্যাক সহ

2mg / শিশি

সিএসিসি-1২95 ড্যাক ছাড়া

2mg / শিশি

পিটি 141

10mg / শিশি

এমটি-1

10mg / শিশি

এমটি-2

10mg / শিশি

GHRP-2

10mg / শিশি

GHRP-2

5mg / শিশি

GHRP -6

10mg / শিশি

GHRP -6

5mg / শিশি

Ipamorelin

2mg / শিশি

Hexarelin

2mg / শিশি

Sermorelin

2mg / শিশি

oxytocin

2mg / শিশি

TB500

2mg / শিশি

প্যান্টেডাক্যাপাইটাইড বিপিসি 157

2mg / শিশি

এইচ এইচGH 176-191

2mg / শিশি

Triptorelin 2mg / শিশি
Tesamorelin 2mg / শিশি
Gonadorelin 2mg / শিশি
Gonadorelin 10mg / শিশি
DSIP 2mg / শিশি
Selank 5mg / শিশি



যোগাযোগের ঠিকানা
Shenzhen Haiwen Biotechnology Co.,Ltd

ব্যক্তি যোগাযোগ: Mrs. Lisa

আমাদের সরাসরি আপনার তদন্ত পাঠান (0 / 3000)

অন্যান্য পণ্যসমূহ

99.5% উচ্চ বিশুদ্ধতা মিনিক্সিডিল ইউএসপি 34 হেয়ার গ্রাউথ পাউডার ফার্মাসিউটিক্যাল CAS 38304-91-5

BPH চুল বৃদ্ধি পাউডার Avodart / Dutasteride 164656-23-9 Duagen

Lyophilized ইনজেক্ট 2mg / শিরা চুল বৃদ্ধি স্টেরয়েড Sermorelin Polypeptide

মৌখিক হংকেনফিলাইল চুল বৃদ্ধি পাউডার হোয়াইট ক্রিস্টালাইন সিএএস 98319-26-7

এফ্রোডিসিয়াস পেপটাইড হোয়াইট হেয়ার গ্রোথ স্টেরয়েড পিটি 141 অ্যাসেটেট সিএএস 32780-32-8

স্বাস্থ্য 99% চুল বৃদ্ধি পাউডার Dutasteride Avodart এন্টি-এস্ট্রোজেন স্টেরয়েড

হোয়াইট ক্রিস্টালিন সলিড চুল বৃদ্ধি স্টেরয়েড Finasteride Proscar এন্টি-এস্ট্রোজেন স্টেরয়েড