শেনঝেন হাইওয়ে বায়োটেকনোলজি কোং লিমিটেড রায় স্টেরয়েড পাউডার উত্পাদন, আধা-সমাপ্ত তেল, লিকুইড, এইচজিএইচ, পেপটাইডস এবং চীনে স্থানীয় অ্যানথেটিক ড্রাগস।

বিক্রয়
উদ্ধৃতির জন্য আবেদন -
Select Language
বাড়ি
পণ্য
আমাদের সম্পর্কে
কারখানা ভ্রমণ
মান নিয়ন্ত্রণ
আমাদের সাথে যোগাযোগ করুন
উদ্ধৃতির জন্য আবেদন
English
French
German
Italian
Russian
Spanish
Portuguese
Dutch
Greek
Japanese
Korean
Arabic
Hindi
Turkish
Indonesian
Vietnamese
Thai
Bengali
Persian
Polish
বাড়িপণ্য

চুল বৃদ্ধি পাউডার

আমি আমার পণ্য পেয়েছি, আপনি প্যাকিং বুদ্ধিমান এবং নিখুঁত করা হয়, এটা সত্যিই আমাকে বিস্মিত। আমি যত তাড়াতাড়ি সম্ভব আপনার কাছ থেকে আরো অর্ডার হবে। Tks!

—— Robet--Australia

আমি আপনার সাথে বহুবার সহযোগিতা করেছি, আপনার পণ্য গুণমান এত বড়, তাই আমি এখনও আপনার কাছ থেকে পণ্য কিনেছি। ধন্যবাদ

—— Richard---American

হাই সাথি, আপনার সেরা মূল্য এবং উচ্চ বিশুদ্ধতা পণ্য আমার দেশে এত প্রতিযোগিতামূলক, এটি আমাকে অনেক লাভ করতে দেয়, আমার গ্রাহকরা সত্যিই এটি পছন্দ করেন। টক্স

—— Johnson---Canada

তোমার দর্শন লগ করা অনলাইন চ্যাট এখন

চুল বৃদ্ধি পাউডার

(115)
China 99.5% উচ্চ বিশুদ্ধতা মিনিক্সিডিল ইউএসপি 34 হেয়ার গ্রাউথ পাউডার ফার্মাসিউটিক্যাল CAS 38304-91-5 distributor

99.5% উচ্চ বিশুদ্ধতা মিনিক্সিডিল ইউএসপি 34 হেয়ার গ্রাউথ পাউডার ফার্মাসিউটিক্যাল CAS 38304-91-5

99.5% উচ্চ বিশুদ্ধতা মিনিক্সিডিল ইউএসপি 34 হেয়ার গ্রাউথ পাউডার ফার্মাসিউটিক্যাল CAS 38304-91-5 দ্রুত বিস্তারিত: মিনক্সিডিল বা মিনক্সিডিল সালফেট এক ধরনের হাইপোটেন্সিভ, রক্তচাপ হ্রাস, বহিরাগত প্ররোচনা চুল পুনরুত...    আরো পড়ুন
2019-03-13 17:06:34
China BPH চুল বৃদ্ধি পাউডার Avodart / Dutasteride 164656-23-9 Duagen distributor

BPH চুল বৃদ্ধি পাউডার Avodart / Dutasteride 164656-23-9 Duagen

BPH চুল বৃদ্ধি পাউডার Avodart / Dutasteride 164656-23-9 Duagen Dutasteride (Avodart) পণ্য নাম: Dutasteride আণবিক ওজন: L28.5297 InChI: nChI = 1 / C27H30F6N2O2 / C1-24-11-9-17-15 (4-8-21-25 (17,2) 12-10-22 (36) ...    আরো পড়ুন
2019-03-13 17:06:29
China Lyophilized ইনজেক্ট 2mg / শিরা চুল বৃদ্ধি স্টেরয়েড Sermorelin Polypeptide distributor

Lyophilized ইনজেক্ট 2mg / শিরা চুল বৃদ্ধি স্টেরয়েড Sermorelin Polypeptide

Lyophilized ইনজেক্ট 2mg / শিরা চুল বৃদ্ধি স্টেরয়েড Sermorelin Polypeptide দ্রুত বিস্তারিত: পণ্য নাম: Sermorelin বিশেষণ প্রতিশব্দ: সেরোমরিন; সেরমরিন অ্যাকটেট; YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2; TYR-ALA-ASP-ALA...    আরো পড়ুন
2019-03-13 17:06:33
China মৌখিক হংকেনফিলাইল চুল বৃদ্ধি পাউডার হোয়াইট ক্রিস্টালাইন সিএএস 98319-26-7 distributor

মৌখিক হংকেনফিলাইল চুল বৃদ্ধি পাউডার হোয়াইট ক্রিস্টালাইন সিএএস 98319-26-7

মৌখিক হংকেনাফিল চুল বৃদ্ধি পাউডার সাদা স্ফটিক CAS 98319-26-7 দ্রুত বিস্তারিত: পণ্যের নাম Hongdenafil অন্য নাম Acetildenafil সিএএস রেজিস্টার নম্বর 831217-01-7 আণবিক সূত্র C25H34N6O3 আণবিক ভর 466,583 চেহারা হোয়া...    আরো পড়ুন
2019-03-13 17:06:25
China এফ্রোডিসিয়াস পেপটাইড হোয়াইট হেয়ার গ্রোথ স্টেরয়েড পিটি 141 অ্যাসেটেট সিএএস 32780-32-8 distributor

এফ্রোডিসিয়াস পেপটাইড হোয়াইট হেয়ার গ্রোথ স্টেরয়েড পিটি 141 অ্যাসেটেট সিএএস 32780-32-8

এফ্রোডিসিয়াস পেপটাইড হোয়াইট হেয়ার গ্রোথ স্টেরয়েড পিটি 141 অ্যাসেটেট সিএএস 32780-32-8 দ্রুত বিস্তারিত: Bremelanotide; পিটি 141 CAS নং .: 32780-32-8 MOQ: 20 ভিয়াল বিশুদ্ধতা (এইচপিএলসি): 98.0% মিনিট। আণবিক সূ...    আরো পড়ুন
2019-03-13 17:06:27
China স্বাস্থ্য 99% চুল বৃদ্ধি পাউডার Dutasteride Avodart এন্টি-এস্ট্রোজেন স্টেরয়েড distributor

স্বাস্থ্য 99% চুল বৃদ্ধি পাউডার Dutasteride Avodart এন্টি-এস্ট্রোজেন স্টেরয়েড

স্বাস্থ্য 99% চুল বৃদ্ধি পাউডার Dutasteride Avodart এন্টি-এস্ট্রোজেন স্টেরয়েড দ্রুত বিস্তারিত: পণ্য নাম; Dutasteride উপনাম; Avodart সিএএস নং .164656-23-9 আণবিক সূত্র; C27H30F6N2O2 আণবিক ওজন; 528.53 চেহারা; সাদ...    আরো পড়ুন
2019-03-13 17:06:20
China হোয়াইট ক্রিস্টালিন সলিড চুল বৃদ্ধি স্টেরয়েড Finasteride Proscar এন্টি-এস্ট্রোজেন স্টেরয়েড distributor

হোয়াইট ক্রিস্টালিন সলিড চুল বৃদ্ধি স্টেরয়েড Finasteride Proscar এন্টি-এস্ট্রোজেন স্টেরয়েড

হোয়াইট ক্রিস্টালিন সলিড চুল বৃদ্ধি স্টেরয়েড Finasteride Proscar এন্টি-এস্ট্রোজেন স্টেরয়েড দ্রুত বিস্তারিত: পণ্যের নাম: Finasteride এলিয়াস: Proscar CAS: 98319-26-7 এমএফ: C23H36N2O2 মেগাওয়াট: 37২.55 বিশুদ্ধত...    আরো পড়ুন
2019-03-13 17:06:20
China 98319-26-7 চুল বৃদ্ধি পাউডার Finasteride Propecia চুল ক্ষতি আচরণ distributor

98319-26-7 চুল বৃদ্ধি পাউডার Finasteride Propecia চুল ক্ষতি আচরণ

98319-26-7 চুল বৃদ্ধি পাউডার Finasteride Propecia চুল ক্ষতি আচরণ দ্রুত বিস্তারিত: পণ্যের নাম Finasteride সিএএস রেজিস্ট্রেশন নম্বর 98319-26-7 আণবিক সূত্র C23H36N2O2 আণবিক ভর 372.5441 InChI : InChI = 1 / ...    আরো পড়ুন
2019-03-13 17:06:02
China সম্ভাব্য হার্বাল এক্সট্র্যাক চুল বৃদ্ধি স্টেরয়েড মিনক্সিডিল CAS 38304-91-5 distributor

সম্ভাব্য হার্বাল এক্সট্র্যাক চুল বৃদ্ধি স্টেরয়েড মিনক্সিডিল CAS 38304-91-5

সম্ভাব্য হার্বাল এক্সট্র্যাক চুল বৃদ্ধি স্টেরয়েড মিনক্সিডিল CAS 38304-91-5 প্রিয়, SMQ যেমন রপ্তানি হয়েছে 12 বছরের জন্য পণ্য , ভাল মূল্য এবং দ্রুত প্রতিক্রিয়া সঙ্গে উচ্চ মানের , Ycsmq@yuanchengtech.com স্কাই...    আরো পড়ুন
2019-03-13 17:06:09
China প্রাকৃতিক চুল বৃদ্ধি পাউডার 57-85-2 Testoviron Testosterone Propionate পাউডার distributor

প্রাকৃতিক চুল বৃদ্ধি পাউডার 57-85-2 Testoviron Testosterone Propionate পাউডার

প্রাকৃতিক চুল বৃদ্ধি পাউডার 57-85-2 Testoviron Testosterone Propionate পাউডার 1. দ্রুত বিস্তারিত: ইংরেজি নাম: Testosterone Propionate ইংরেজি নাম: 17 বিটা- (Propionyloxy) androst-4-en-3-one; 17 বিটা-হাইড্রক্সি ...    আরো পড়ুন
2019-03-13 17:06:15
Page 1 of 12 |< << 1  2  3  4  5  6  7  8  9  10  >> >|